PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 919450
Common NameARALYDRAFT_919450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARF
Protein Properties Length: 859aa    MW: 95465.6 Da    PI: 6.6331
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
919450genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.51.1e-22160261199
             EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
             f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++ ++W++++i+r++++r++l++GW+ Fv++++L +gD ++F   + +++el+v+v+
  919450 160 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHANEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL--RGENGELRVGVR 259
             99*****************************7333.34459************************************************..449999*****9 PP

             -S CS
      B3  98 rk 99 
             r+
  919450 260 RA 261
             96 PP

2Auxin_resp118.84.3e-39286368183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha+st+++F+v+Y+Pr+s+seF+v+++++++++k+++s+GmRfkm+fe+e+++e+r++Gt+vg++d+d +rWp+SkWrsLk
      919450 286 AWHAISTGTMFTVYYKPRTSPSEFIVPFDQYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDSDITRWPKSKWRSLK 368
                 89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.2E-40156275IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-40157289IPR015300DNA-binding pseudobarrel domain
CDDcd100171.46E-20158260No hitNo description
SMARTSM010194.1E-22160262IPR003340B3 DNA binding domain
PfamPF023621.5E-20160261IPR003340B3 DNA binding domain
PROSITE profilePS5086311.42160262IPR003340B3 DNA binding domain
PfamPF065071.6E-36286368IPR010525Auxin response factor
PfamPF023092.2E-9720818IPR033389AUX/IAA domain
SuperFamilySSF542771.03E-11732810No hitNo description
PROSITE profilePS5174525.174733817IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 859 aa     Download sequence    Send to blast
MASSEVSMKG NRGGDNFSSS AFSDPKETRN GEGQKSNSSR PAAAERAVDP EAALYRELWH  60
ACAGPLVTVP RQDDRVFYFP QGHIEQVEAS TNQAAEQQMP LYDLPSKLLC RVINVDLKAE  120
ADTDEVYAQI TLLPEANQDE NAIEKEAPPP PPPRFQVHSF CKTLTASDTS THGGFSVLRR  180
HADECLPPLD MSRQPPTQEL VAKDLHANEW RFRHIFRGQP RRHLLQSGWS VFVSSKRLVA  240
GDAFIFLRGE NGELRVGVRR AMRQQGNVPS SVISSHSMHL GVLATAWHAI STGTMFTVYY  300
KPRTSPSEFI VPFDQYMESV KNNYSIGMRF KMRFEGEEAP EQRFTGTIVG IEDSDITRWP  360
KSKWRSLKVR WDETSSIPRP DRVSPWKIEP ALAPPALSPV PMPRPKRPRS NIAPSSPDSS  420
MLTREGTTKA NMDPLPASGL SRVLQGQEYS TLRTKHTESV ECDAPENSVV WQSSADDDKV  480
DVVSCSRRYG SENWMPSARH EPTYTDLLSG FGANIEPSHG QRIPFYDHSS SPSMPAKNIL  540
SDPEGKFDFL ANQWQMMQSG LSLKLHESPK VPAATDASFQ GRGNVKYSEY PVLNGLSTEN  600
AGGNWPIRPR ALNYYEEVVH AQAQAQAQAQ AREQATKQPV TIQEETAKSR EGNCRLFGIP  660
LSNNMNGTDS AMSQRSNLND AAGLTQLASP KVQDLPDQSK GSKSTNDHRE QGRPFQTNNP  720
HPKDAHTKSN SSRSCTKVHK QGIALGRSVD LSKFQNYEEL IAELDRLFEF NGELMAPKKD  780
WLIVYTDDEN DMMLVGDDPW QEFCCMVRKI FIYTKEEVRK MNPGTLSCRS EEGVVGEGSD  840
AKDAKSASNP SLSSAGNS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.05339018354Auxin response factor 1
4ldw_A0.05339018354Auxin response factor 1
4ldw_B0.05339018354Auxin response factor 1
4ldx_A0.05339018354Auxin response factor 1
4ldx_B0.05339018354Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2212520.0AK221252.1 Arabidopsis thaliana mRNA for ARF1-binding protein, complete cds, clone: RAFL24-07-O11.
GenBankAK2212540.0AK221254.1 Arabidopsis thaliana mRNA for ARF1-binding protein, complete cds, clone: RAFL24-09-L23.
GenBankAK2212740.0AK221274.1 Arabidopsis thaliana mRNA for ARF1-binding protein, complete cds, clone: RAFL24-16-M02.
GenBankAK2213050.0AK221305.1 Arabidopsis thaliana mRNA for ARF1-binding protein, complete cds, clone: RAFL24-31-F22.
GenBankBT0007840.0BT000784.1 Arabidopsis thaliana clone RAFL07-10-G12 (R10939) auxin response factor (At5g62000) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002864764.10.0hypothetical protein ARALYDRAFT_919450
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLD7MKQ00.0D7MKQ0_ARALL; Auxin response factor
STRINGscaffold_802850.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53482647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2